PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03120g01003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 207aa    MW: 22795.4 Da    PI: 4.2194
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03120g01003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.34.1e-13349349
                              --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                    SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                              ++++s r+  +s+  + ++KKA+ LS+LCd+eva++i s++ ++ e 
  Peinf101Scf03120g01003.1  3 SKSESERKALLSRNVACLFKKAQKLSILCDVEVALLISSPDENMAEL 49
                              688999999999999***************************99885 PP

2SRF-TF34.13.5e-11102148349
                               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                    SRF-TF   3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 
                               ++++s r+  +s+  + ++KKA+ LS+LCd+e+a+ i  ++ ++ e 
  Peinf101Scf03120g01003.1 102 SKSESERKALLSRNVASLFKKAQKLSILCDVEIALFISNPDENMEEL 148
                               678899999999999************************99999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0017152IPR002100Transcription factor, MADS-box
PfamPF003198.1E-11446IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.096453IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-11566IPR002100Transcription factor, MADS-box
SMARTSM004320.004957151IPR002100Transcription factor, MADS-box
PfamPF003192.7E-9103145IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.788103152IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-10104165IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MASKSESERK ALLSRNVACL FKKAQKLSIL CDVEVALLIS SPDENMAELA TFKMANVEEK  60
RKQLDEEDVQ PVEPPVAGDE SGTRPEPAEG TQSQTLLPNI ASKSESERKA LLSRNVASLF  120
KKAQKLSILC DVEIALFISN PDENMEELAT FKMANVEEKR KQLDEEDVQP VEPPVAGDES  180
STRPEPAEGD NNNAGEEKDD EHPKDSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.16e-07MIKC_MADS family protein